SCOPe 2.01: Domain d2f9bt2: 2f9b T:109-205

Lineage for d2f9bt2 (2f9b T:109-205)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Extracellular region of human tissue factor [49267] (2 species)
   tandem of fibronectin type III domains

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [49269] (18 PDB entries)

8. Domain d2f9bt2: 2f9b T:109-205 [133157]
   Other proteins in same PDB: d2f9bh_
   automatically matched to d1a21a2
   complexed with n1h

Details for d2f9bt2

PDB Entry: 2f9b, 2.54 Å

PDB Description: discovery of novel heterocyclic factor viia inhibitors

PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d2f9bt2:

Sequence, based on SEQRES records:

>d2f9bt2 b.1.2.1 (T:109-205) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkkta
ktntneflidvdkgenycfsvqavipsrtvnrkstds

Sequence, based on observed residues (ATOM records):

>d2f9bt2 b.1.2.1 (T:109-205) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gdertlvrrnntflslrdvfgkdliytlsvqavipsrtvnrkstds

Timeline for d2f9bt2:

• d2f9bt2 first appeared in SCOP 1.73
  
• d2f9bt2 appears in SCOP 1.75
  
• d2f9bt2 appears in SCOPe 2.02
  
• d2f9bt2 appears in the current release, SCOPe 2.08