Lineage for d2f2va_ (2f2v A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309919Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1310020Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1310021Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1310045Protein alpha-Spectrin, SH3 domain [50058] (1 species)
  7. 1310046Species Chicken (Gallus gallus) [TaxId:9031] [50059] (29 PDB entries)
  8. 1310056Domain d2f2va_: 2f2v A: [132849]
    automated match to d1pwt__
    complexed with fmt; mutant

Details for d2f2va_

PDB Entry: 2f2v (more details), 1.85 Å

PDB Description: alpha-spectrin sh3 domain a56g mutant
PDB Compounds: (A:) Spectrin alpha chain, brain

SCOPe Domain Sequences for d2f2va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f2va_ b.34.2.1 (A:) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]}
mdetgkelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevndrqgfvpagyvkk
ld

SCOPe Domain Coordinates for d2f2va_:

Click to download the PDB-style file with coordinates for d2f2va_.
(The format of our PDB-style files is described here.)

Timeline for d2f2va_: