Class b: All beta proteins [48724] (174 folds) |
Fold b.150: Putative glucosidase YicI, C-terminal domain [117124] (1 superfamily) sandwich; 10 strands in two sheets |
Superfamily b.150.1: Putative glucosidase YicI, C-terminal domain [117125] (1 family) |
Family b.150.1.1: Putative glucosidase YicI, C-terminal domain [117126] (1 protein) |
Protein Putative glucosidase YicI, C-terminal domain [117127] (1 species) |
Species Escherichia coli [TaxId:562] [117128] (5 PDB entries) Uniprot P31434 |
Domain d2f2he1: 2f2h E:666-773 [132834] Other proteins in same PDB: d2f2ha2, d2f2ha3, d2f2ha4, d2f2hb2, d2f2hb3, d2f2hb4, d2f2hc2, d2f2hc3, d2f2hc4, d2f2hd2, d2f2hd3, d2f2hd4, d2f2he2, d2f2he3, d2f2he4, d2f2hf2, d2f2hf3, d2f2hf4 automatically matched to 2F2H A:666-773 complexed with gol, mpo, so4, xtg |
PDB Entry: 2f2h (more details), 1.95 Å
SCOPe Domain Sequences for d2f2he1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f2he1 b.150.1.1 (E:666-773) Putative glucosidase YicI, C-terminal domain {Escherichia coli [TaxId: 562]} ntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartgntitv tgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlh
Timeline for d2f2he1: