Lineage for d2f1de2 (2f1d E:96-192)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1016991Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1016992Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1017517Family d.14.1.9: Imidazole glycerol phosphate dehydratase [102766] (1 protein)
    duplication; there are two structural repeats of this fold
  6. 1017518Protein Imidazole glycerol phosphate dehydratase [102767] (3 species)
  7. 1017537Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142926] (1 PDB entry)
    Uniprot P34047 159-255! Uniprot P34047 73-158
  8. 1017547Domain d2f1de2: 2f1d E:96-192 [132737]
    automatically matched to 2F1D A:96-192
    complexed with mn, so4

Details for d2f1de2

PDB Entry: 2f1d (more details), 3 Å

PDB Description: X-Ray Structure of imidazoleglycerol-phosphate dehydratase
PDB Compounds: (E:) Imidazoleglycerol-phosphate dehydratase 1

SCOPe Domain Sequences for d2f1de2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f1de2 d.14.1.9 (E:96-192) Imidazole glycerol phosphate dehydratase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
ginrfgdftapldealihvsldlsgrpylgynleiptqrvgtydtqlvehffqslvntsg
mtlhirqlagenshhiieatfkafaralrqatetdpr

SCOPe Domain Coordinates for d2f1de2:

Click to download the PDB-style file with coordinates for d2f1de2.
(The format of our PDB-style files is described here.)

Timeline for d2f1de2: