Lineage for d2f0xe_ (2f0x E:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1201078Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1201079Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1201307Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. 1201400Protein automated matches [190102] (5 species)
    not a true protein
  7. 1201428Species Human (Homo sapiens) [TaxId:9606] [187682] (2 PDB entries)
  8. 1201440Domain d2f0xe_: 2f0x E: [132677]
    Other proteins in same PDB: d2f0xa1
    automated match to d2f0xa1
    complexed with so4

Details for d2f0xe_

PDB Entry: 2f0x (more details), 2.3 Å

PDB Description: crystal structure and function of human thioesterase superfamily member 2(them2)
PDB Compounds: (E:) Thioesterase superfamily member 2

SCOPe Domain Sequences for d2f0xe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f0xe_ d.38.1.5 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhggltatl
vdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdltnk
atgkliaqgrhtkhl

SCOPe Domain Coordinates for d2f0xe_:

Click to download the PDB-style file with coordinates for d2f0xe_.
(The format of our PDB-style files is described here.)

Timeline for d2f0xe_: