SCOPe 2.02: Domain d2f0ad_: 2f0a D:

Lineage for d2f0ad_ (2f0a D:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Segment polarity protein dishevelled homolog Dvl-2 [89313] (3 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [89314] (2 PDB entries)

8. Domain d2f0ad_: 2f0a D: [132664]
   automated match to d1l6oa_
   complexed with co, so4

Details for d2f0ad_

PDB Entry: 2f0a, 1.8 Å

PDB Description: crystal structure of monomeric uncomplexed form of xenopus dishevelled pdz domain

PDB Compounds: (D:) Segment polarity protein dishevelled homolog DVL-2

SCOPe Domain Sequences for d2f0ad_:

Sequence, based on SEQRES records:

>d2f0ad_ b.36.1.1 (D:) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
miitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvndi
nfenmsnddavrvlrdivhkpgpivltvaklehhhhhh

Sequence, based on observed residues (ATOM records):

>d2f0ad_ b.36.1.1 (D:) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
miitvtlnmekynflgisivgqgiyigsimkggavaadgriepgdmllqvndinfenmsn
ddavrvlrdivhkpivltvaklehhhhhh

Timeline for d2f0ad_:

• d2f0ad_ first appeared in SCOP 1.73, called d2f0ad1
  
• d2f0ad_ appears in SCOPe 2.01
  
• d2f0ad_ appears in SCOPe 2.03
  
• d2f0ad_ appears in the current release, SCOPe 2.08, called d2f0ad2