SCOP 1.73: Domain d2eztb3: 2ezt B:366-593

Lineage for d2eztb3 (2ezt B:366-593)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins)
   the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology

6. Protein Pyruvate oxidase [88754] (2 species)

7. Species Lactobacillus plantarum [TaxId:1590] [88755] (7 PDB entries)

8. Domain d2eztb3: 2ezt B:366-593 [132638]
   Other proteins in same PDB: d2ezta1, d2ezta2, d2eztb1, d2eztb2
   automatically matched to d1powa3
   complexed with fad, mg, na, po4, pyr, tdm; mutant

Details for d2eztb3

PDB Entry: 2ezt, 2.29 Å

PDB Description: pyruvate oxidase variant f479w in complex with reaction intermediate 2-hydroxyethyl-thiamin diphosphate

PDB Compounds: (B:) Pyruvate oxidase

SCOP Domain Sequences for d2eztb3:

Sequence; same for both SEQRES and ATOM records:

>d2eztb3 c.36.1.9 (B:366-593) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]}
kqegplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfatmgvg
ipgaiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygwikdeqe
dtnqndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvlidavit
gdrplpaeklrldsamssaadieafkqryeaqdlqplstylkqfgldd

Timeline for d2eztb3:

• d2eztb3 is new in SCOP 1.73
  
• d2eztb3 appears in SCOP 1.75
  
• d2eztb3 appears in the current release, SCOPe 2.08