Lineage for d2ezta1 (2ezt A:183-365)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 694236Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 694237Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (6 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 694262Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 694361Protein Pyruvate oxidase [52476] (2 species)
    binds FAD
  7. 694367Species Lactobacillus plantarum [TaxId:1590] [52477] (7 PDB entries)
  8. 694376Domain d2ezta1: 2ezt A:183-365 [132633]
    Other proteins in same PDB: d2ezta2, d2ezta3, d2eztb2, d2eztb3
    automatically matched to d1powa1
    complexed with fad, mg, na, po4, pyr, tdm; mutant

Details for d2ezta1

PDB Entry: 2ezt (more details), 2.29 Å

PDB Description: pyruvate oxidase variant f479w in complex with reaction intermediate 2-hydroxyethyl-thiamin diphosphate
PDB Compounds: (A:) Pyruvate oxidase

SCOP Domain Sequences for d2ezta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ezta1 c.31.1.3 (A:183-365) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]}
yasansyqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkiplm
stypakgivadrypaylgsanrvaqkpanealaqadvvlfvgnnypfaevskafkntryf
lqididpaklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwraylas
led

SCOP Domain Coordinates for d2ezta1:

Click to download the PDB-style file with coordinates for d2ezta1.
(The format of our PDB-style files is described here.)

Timeline for d2ezta1: