Lineage for d2ewcj_ (2ewc J:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1914038Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1914039Superfamily d.79.1: YjgF-like [55298] (3 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 1914040Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins)
    some members possess an endoribonuclease activity inhibiting mRNA translation
  6. 1914084Protein Hypothetical protein SPy2060 [143527] (1 species)
  7. 1914085Species Streptococcus pyogenes [TaxId:1314] [143528] (1 PDB entry)
    Uniprot Q99XS4 3-122
  8. 1914095Domain d2ewcj_: 2ewc J: [132463]
    automated match to d2ewca1
    complexed with gol

Details for d2ewcj_

PDB Entry: 2ewc (more details), 2.15 Å

PDB Description: structure of hypothetical protein from streptococcus pyogenes m1 gas, member of highly conserved yjgf family of proteins
PDB Compounds: (J:) conserved hypothetical protein

SCOPe Domain Sequences for d2ewcj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ewcj_ d.79.1.1 (J:) Hypothetical protein SPy2060 {Streptococcus pyogenes [TaxId: 1314]}
tirrydvnedrghtglveagdfyylnycvgnvgqdiesqingafdemerrlalvgltlda
vvqmdclfrdvwnipvmekmikerfngryparksiqtefahhggpqgllfqvdgvayskh

SCOPe Domain Coordinates for d2ewcj_:

Click to download the PDB-style file with coordinates for d2ewcj_.
(The format of our PDB-style files is described here.)

Timeline for d2ewcj_: