Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
Protein Galactose oxidase, C-terminal domain [49209] (3 species) follows the catalytic seven-bladed beta-propeller domain |
Species Fusarium graminearum (Gibberella zeae) [TaxId:5518] [158881] (6 PDB entries) |
Domain d2eiba1: 2eib A:538-639 [132127] Other proteins in same PDB: d2eiba2, d2eiba3 automated match to d1gofa1 complexed with act, cu, na, so4; mutant |
PDB Entry: 2eib (more details), 2.1 Å
SCOPe Domain Sequences for d2eiba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eiba1 b.1.18.2 (A:538-639) Galactose oxidase, C-terminal domain {Fusarium graminearum (Gibberella zeae) [TaxId: 5518]} gnlatrpkitrtstqsvkvggritistdssiskaslirygtathtvntdqrripltltnn ggnsysfqvpsdsgvalpgywmlfvmnsagvpsvastirvtq
Timeline for d2eiba1: