Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156 |
Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families) the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase |
Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (2 proteins) |
Protein automated matches [190121] (2 species) not a true protein |
Species Escherichia coli [TaxId:562] [186844] (9 PDB entries) |
Domain d2e98a_: 2e98 A: [132094] automated match to d1jp3a_ complexed with b29 |
PDB Entry: 2e98 (more details), 1.9 Å
SCOPe Domain Sequences for d2e98a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e98a_ c.101.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]} ahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafssen wnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagn tgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvir tggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre
Timeline for d2e98a_: