Lineage for d2e5lo1 (2e5l O:2-89)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725387Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 1725388Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. 1725434Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
    contains additional N-terminal helix that forms a separate unit
    automatically mapped to Pfam PF00312
  6. 1725435Protein Ribosomal protein S15 [47065] (3 species)
  7. 1725449Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries)
    Uniprot P80378
  8. 1725470Domain d2e5lo1: 2e5l O:2-89 [132039]
    Other proteins in same PDB: d2e5lc1, d2e5lc2, d2e5ld1, d2e5le1, d2e5le2, d2e5lf1, d2e5lg1, d2e5lh1, d2e5li1, d2e5lj1, d2e5lk1, d2e5ll1, d2e5lm1, d2e5ln1, d2e5lp1, d2e5lq1, d2e5lr1, d2e5ls1, d2e5lt1, d2e5lv1
    automatically matched to d1ab3__
    complexed with zn

Details for d2e5lo1

PDB Entry: 2e5l (more details), 3.3 Å

PDB Description: a snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
PDB Compounds: (O:) 30S ribosomal protein S15

SCOPe Domain Sequences for d2e5lo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e5lo1 a.16.1.2 (O:2-89) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOPe Domain Coordinates for d2e5lo1:

Click to download the PDB-style file with coordinates for d2e5lo1.
(The format of our PDB-style files is described here.)

Timeline for d2e5lo1: