Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily) core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (1 family) |
Family d.78.1.1: RPB5 [55288] (2 proteins) |
Protein Eukaryotic RPB5 C-terminal domain [55292] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (25 PDB entries) Uniprot P20434; part of multichain biological unit |
Domain d2e2he2: 2e2h E:144-215 [131986] Other proteins in same PDB: d2e2ha1, d2e2hb1, d2e2hc1, d2e2hc2, d2e2he1, d2e2hf1, d2e2hh1, d2e2hi1, d2e2hi2, d2e2hj1, d2e2hk1, d2e2hl1 automatically matched to d1dzfa2 protein/DNA complex; protein/RNA complex; complexed with gtp, mg, zn |
PDB Entry: 2e2h (more details), 3.95 Å
SCOPe Domain Sequences for d2e2he2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e2he2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse tsgryasyricm
Timeline for d2e2he2: