Class b: All beta proteins [48724] (174 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (11 families) probable carbohydrate-binding domain in enzymes acting on sugars |
Family b.30.5.2: Hyaluronate lyase-like, central domain [50006] (4 proteins) |
Protein Xanthan lyase [89282] (1 species) |
Species Bacillus sp. GL1 [TaxId:84635] [89283] (7 PDB entries) |
Domain d2e24a3: 2e24 A:387-659 [131978] Other proteins in same PDB: d2e24a1, d2e24a2 automatically matched to d1j0ma3 complexed with peg; mutant |
PDB Entry: 2e24 (more details), 2.15 Å
SCOPe Domain Sequences for d2e24a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e24a3 b.30.5.2 (A:387-659) Xanthan lyase {Bacillus sp. GL1 [TaxId: 84635]} pnlykqyaamdravlqrpgfalglalystrissyesinsengrgwytgagatylynqdla qysedywptvdayripgttvasgtpiasgtgtsswtggvslagqygasgmdlsygaynls arkswfmfddeivalgsgisstagipietvvdnrklngagdnawtangaalstglgvaqt ltgvnwvhlagntadgsdigyyfpggatlqtkreartgtwkqinnapatpstavtrnyet mwidhgtnpsgasygyvllpnktsaqvgayaad
Timeline for d2e24a3: