Lineage for d2dyaa_ (2dya A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1027566Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 1027567Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 1027568Protein Nucleoside diphosphate kinase, NDK [54921] (21 species)
  7. 1027701Species Pyrococcus horikoshii [TaxId:53953] [143284] (6 PDB entries)
    Uniprot O58429 3-155
  8. 1027702Domain d2dyaa_: 2dya A: [131895]
    automated match to d2cwka1
    complexed with adp, cl, mg

Details for d2dyaa_

PDB Entry: 2dya (more details), 1.77 Å

PDB Description: Crystal structure of complex between Adenine nucleotide and nucleoside diphosphate kinase
PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d2dyaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dyaa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Pyrococcus horikoshii [TaxId: 53953]}
setertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehrekpff
kalidyitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaicnvih
asdskesaereislffkpeelfeypraadwfykk

SCOPe Domain Coordinates for d2dyaa_:

Click to download the PDB-style file with coordinates for d2dyaa_.
(The format of our PDB-style files is described here.)

Timeline for d2dyaa_: