Lineage for d2dpja1 (2dpj A:300-414)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1230243Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 1230244Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (1 family) (S)
  5. 1230245Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)
  6. 1230333Protein DNA polymerase iota [111015] (1 species)
  7. 1230334Species Human (Homo sapiens) [TaxId:9606] [111016] (8 PDB entries)
    Uniprot Q9UNA4
  8. 1230337Domain d2dpja1: 2dpj A:300-414 [131614]
    Other proteins in same PDB: d2dpja2
    automatically matched to d1t3na1
    protein/DNA complex; complexed with mg, ttp

Details for d2dpja1

PDB Entry: 2dpj (more details), 2.3 Å

PDB Description: structure of hPoli with DNA and dTTP
PDB Compounds: (A:) DNA polymerase iota

SCOPe Domain Sequences for d2dpja1:

Sequence, based on SEQRES records: (download)

>d2dpja1 d.240.1.1 (A:300-414) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]}
qsfseedsfkkcsseveaknkieellasllnrvcqdgrkphtvrliirryssekhygres
rqcpipshviqklgtgnydvmtpmvdilmklfrnmvnvkmpfhltllsvcfcnlk

Sequence, based on observed residues (ATOM records): (download)

>d2dpja1 d.240.1.1 (A:300-414) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]}
qsfseedsfkkcsseveaknkieellasllnrvcqdgrkphtvrliirryssekhygres
rqcpipshviqvmtpmvdilmklfrnmtllsvcfcnlk

SCOPe Domain Coordinates for d2dpja1:

Click to download the PDB-style file with coordinates for d2dpja1.
(The format of our PDB-style files is described here.)

Timeline for d2dpja1: