Lineage for d2dkgb2 (2dkg B:1-188)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208545Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2208546Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2208816Family d.104.1.2: Biotin holoenzyme synthetase [55707] (3 proteins)
  6. 2208825Protein Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain [143640] (1 species)
  7. 2208826Species Pyrococcus horikoshii [TaxId:53953] [143641] (27 PDB entries)
    Uniprot O57883 1-188
  8. 2208870Domain d2dkgb2: 2dkg B:1-188 [131554]
    Other proteins in same PDB: d2dkga1, d2dkgb1
    automated match to d1wnla2
    complexed with bt5, mg, pop

Details for d2dkgb2

PDB Entry: 2dkg (more details), 2 Å

PDB Description: Crystal Structure Of Biotin Protein Ligase From Pyrococcus Horikoshii OT3 in Complex with Biotinyl-5'-AMP, Pyrophosphate and Mg(2+)
PDB Compounds: (B:) 235aa long hypothetical biotin-[acetyl-CoA-carboxylase] ligase

SCOPe Domain Sequences for d2dkgb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dkgb2 d.104.1.2 (B:1-188) Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain {Pyrococcus horikoshii [TaxId: 53953]}
mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl
wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegk
gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
lvrdnmil

SCOPe Domain Coordinates for d2dkgb2:

Click to download the PDB-style file with coordinates for d2dkgb2.
(The format of our PDB-style files is described here.)

Timeline for d2dkgb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dkgb1