Lineage for d2dfna_ (2dfn A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 987470Family c.37.1.2: Shikimate kinase (AroK) [52566] (2 proteins)
    similar to the nucleotide/nucleoside kinases but acts on different substrate
  6. 987471Protein Shikimate kinase (AroK) [52567] (4 species)
  7. 987485Species Mycobacterium tuberculosis [TaxId:1773] [75194] (10 PDB entries)
    Uniprot P95014
  8. 987490Domain d2dfna_: 2dfn A: [131475]
    automated match to d1l4ua_
    complexed with adp, cl, skm

Details for d2dfna_

PDB Entry: 2dfn (more details), 1.93 Å

PDB Description: Structure of shikimate kinase from Mycobacterium tuberculosis complexed with ADP and shikimate at 1.9 angstrons of resolution
PDB Compounds: (A:) Shikimate kinase

SCOPe Domain Sequences for d2dfna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dfna_ c.37.1.2 (A:) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]}
apkavlvglpgsgkstigrrlakalgvglldtdvaieqrtgrsiadifatdgeqefrrie
edvvraaladhdgvlslgggavtspgvraalaghtvvyleisaaegvrrtggntvrplla
gpdraekyralmakraplyrrvatmrvdtnrrnpgavvrhilsrl

SCOPe Domain Coordinates for d2dfna_:

Click to download the PDB-style file with coordinates for d2dfna_.
(The format of our PDB-style files is described here.)

Timeline for d2dfna_: