SCOPe 2.01: Domain d2d7cb_: 2d7c B:

Lineage for d2d7cb_ (2d7c B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab11a [102362] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102363] (5 PDB entries)

8. Domain d2d7cb_: 2d7c B: [131318]
   Other proteins in same PDB: d2d7cc1, d2d7cd1
   automated match to d1oiwa_
   complexed with gtp, mes, mg

Details for d2d7cb_

PDB Entry: 2d7c, 1.75 Å

PDB Description: crystal structure of human rab11 in complex with fip3 rab-binding domain

PDB Compounds: (B:) Ras-related protein Rab-11A

SCOPe Domain Sequences for d2d7cb_:

Sequence; same for both SEQRES and ATOM records:

>d2d7cb_ c.37.1.8 (B:) Rab11a {Human (Homo sapiens) [TaxId: 9606]}
eydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwd
tagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnks
dlrhlravptdearafaeknglsfietsaldstnveaafqtilteiy

Timeline for d2d7cb_:

• d2d7cb_ first appeared in SCOP 1.73, called d2d7cb1
  
• d2d7cb_ was called d2d7cb1 in SCOP 1.75
  
• d2d7cb_ appears in SCOPe 2.02
  
• d2d7cb_ appears in the current release, SCOPe 2.08