Lineage for d2d11a1 (2d11 A:88-198)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1725169Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1725208Superfamily a.11.2: Second domain of FERM [47031] (2 families) (S)
    automatically mapped to Pfam PF00373
  5. 1725209Family a.11.2.1: Second domain of FERM [47032] (9 proteins)
  6. 1725237Protein Radixin [47035] (1 species)
  7. 1725238Species Mouse (Mus musculus) [TaxId:10090] [47036] (9 PDB entries)
  8. 1725246Domain d2d11a1: 2d11 A:88-198 [131109]
    Other proteins in same PDB: d2d11a2, d2d11a3, d2d11b2, d2d11b3, d2d11c2, d2d11c3, d2d11d2, d2d11d3
    automatically matched to d1gc6a1

Details for d2d11a1

PDB Entry: 2d11 (more details), 2.81 Å

PDB Description: Crystal structure of the Radixin FERM domain complexed with the NHERF-2 C-terminal tail peptide
PDB Compounds: (A:) Radixin

SCOPe Domain Sequences for d2d11a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d11a1 a.11.2.1 (A:88-198) Radixin {Mouse (Mus musculus) [TaxId: 10090]}
dvseeliqeitqrlfflqvkeailndeiycppetavllasyavqakygdynkeihkpgyl
andrllpqrvleqhkltkeqweeriqnwheehrgmlredsmmeylkiaqdl

SCOPe Domain Coordinates for d2d11a1:

Click to download the PDB-style file with coordinates for d2d11a1.
(The format of our PDB-style files is described here.)

Timeline for d2d11a1: