Lineage for d2cx4c_ (2cx4 C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1853530Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 1853613Protein Bacterioferritin comigratory protein [142377] (1 species)
  7. 1853614Species Aeropyrum pernix [TaxId:56636] [142378] (4 PDB entries)
    Uniprot Q9YA14 4-163
  8. 1853623Domain d2cx4c_: 2cx4 C: [130975]
    automated match to d2cx3a1

Details for d2cx4c_

PDB Entry: 2cx4 (more details), 2.3 Å

PDB Description: Crystal structure of a bacterioferritin comigratory protein peroxiredoxin from the Aeropyrum pernix K1 (form-2 crystal)
PDB Compounds: (C:) bacterioferritin comigratory protein

SCOPe Domain Sequences for d2cx4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cx4c_ c.47.1.10 (C:) Bacterioferritin comigratory protein {Aeropyrum pernix [TaxId: 56636]}
glvelgekapdftlpnqdfepvnlyevlkrgrpavliffpaafspvctkelctfrdkmaq
lekanaevlaisvdspwclkkfkdenrlafnllsdynreviklynvyhedlkglkmvakr
avfivkpdgtvaykwvtdnplnepdydevvreankiagelv

SCOPe Domain Coordinates for d2cx4c_:

Click to download the PDB-style file with coordinates for d2cx4c_.
(The format of our PDB-style files is described here.)

Timeline for d2cx4c_: