SCOPe 2.08: Domain d2cx3c2: 2cx3 C:5-163

Lineage for d2cx3c2 (2cx3 C:5-163)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein Bacterioferritin comigratory protein [142377] (1 species)

7. Species Aeropyrum pernix [TaxId:56636] [142378] (4 PDB entries)
   Uniprot Q9YA14 4-163

8. Domain d2cx3c2: 2cx3 C:5-163 [130971]
   Other proteins in same PDB: d2cx3a2, d2cx3b3, d2cx3c3, d2cx3d3
   automated match to d2cx3a1

Details for d2cx3c2

PDB Entry: 2cx3, 2.64 Å

PDB Description: Crystal structure of a bacterioferritin comigratory protein peroxiredoxin from the Aeropyrum pernix K1 (form-1 crystal)

PDB Compounds: (C:) bacterioferritin comigratory protein

SCOPe Domain Sequences for d2cx3c2:

Sequence; same for both SEQRES and ATOM records:

>d2cx3c2 c.47.1.10 (C:5-163) Bacterioferritin comigratory protein {Aeropyrum pernix [TaxId: 56636]}
velgekapdftlpnqdfepvnlyevlkrgrpavliffpaafspvctkelctfrdkmaqle
kanaevlaisvdspwclkkfkdenrlafnllsdynreviklynvyhedlkglkmvakrav
fivkpdgtvaykwvtdnplnepdydevvreankiagelv

Timeline for d2cx3c2:

• d2cx3c2 first appeared in SCOP 1.73, called d2cx3c1
  
• d2cx3c2 appears in SCOPe 2.07