SCOPe 2.03: Domain d2cwkb_: 2cwk B:

Lineage for d2cwkb_ (2cwk B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein automated matches [190032] (11 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:70601] [187576] (1 PDB entry)

8. Domain d2cwkb_: 2cwk B: [130926]
   Other proteins in same PDB: d2cwka1
   automated match to d2cwka1

Details for d2cwkb_

PDB Entry: 2cwk, 1.75 Å

PDB Description: Crystal structure of nucleotide diphosphate kinase from Pyrococcus horikoshii

PDB Compounds: (B:) nucleoside-diphosphate kinase

SCOPe Domain Sequences for d2cwkb_:

Sequence; same for both SEQRES and ATOM records:

>d2cwkb_ d.58.6.1 (B:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
etertlviikpdavvrgligeiisrfekkglkivgmkmiwidrelaekhyeehrekpffk
alidyitktpvvvmvlegryavevvrkmagatdpkdaapgtirgdfglevsdaicnviha
sdskesaereislffkpeelfeypraadwfyk

Timeline for d2cwkb_:

• d2cwkb_ first appeared in SCOP 1.73, called d2cwkb1
  
• d2cwkb_ appears in SCOPe 2.02
  
• d2cwkb_ appears in SCOPe 2.04
  
• d2cwkb_ appears in the current release, SCOPe 2.08