SCOPe 2.08: Domain d2cu6a1: 2cu6 A:6-96

Lineage for d2cu6a1 (2cu6 A:6-96)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.8: Fe-S cluster assembly (FSCA) domain-like [117916] (3 families)
   similar putative active site with a conserved cysteine residue

5. Family d.52.8.2: PaaD-like [117922] (3 proteins)
   Pfam PF01883; DUF59

6. Protein Hypothetical protein TTHB138 [143230] (1 species)

7. Species Thermus thermophilus [TaxId:274] [143231] (1 PDB entry)
   Uniprot Q53W28 6-96

8. Domain d2cu6a1: 2cu6 A:6-96 [130803]
   Other proteins in same PDB: d2cu6b_

Details for d2cu6a1

PDB Entry: 2cu6, 2 Å

PDB Description: Crystal Structure Of The dTDP-4-keto-L-rhamnose reductase-related Protein From Thermus Thermophilus HB8

PDB Compounds: (A:) dTDP-4-keto-L-rhamnose reductase-related Protein

SCOPe Domain Sequences for d2cu6a1:

Sequence; same for both SEQRES and ATOM records:

>d2cu6a1 d.52.8.2 (A:6-96) Hypothetical protein TTHB138 {Thermus thermophilus [TaxId: 274]}
pleaqawalleavydpelgldvvnlgliydlvvepprayvrmtlttpgcplhdslgeavr
qalsrlpgveevevevtfeppwtlarlseka

Timeline for d2cu6a1:

• d2cu6a1 first appeared in SCOP 1.73
  
• d2cu6a1 appears in SCOPe 2.07