Lineage for d2cqaa1 (2cqa A:8-89)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1124635Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1125586Family b.40.4.14: TIP49 domain [141315] (1 protein)
    N-terminal part of Pfam PF06068; the RuvA-like OB-fold domain in RuvB-like eukaryotic proteins
  6. 1125587Protein RuvB-like 2 protein, RUVBL2 (TIP49b) [141316] (1 species)
  7. 1125588Species Human (Homo sapiens) [TaxId:9606] [141317] (1 PDB entry)
    Uniprot Q9Y230 131-212
  8. 1125589Domain d2cqaa1: 2cqa A:8-89 [130716]

Details for d2cqaa1

PDB Entry: 2cqa (more details)

PDB Description: solution structure of rsgi ruh-039, a fragment of c-terminal domain of ruvb-like 2 from human cdna
PDB Compounds: (A:) RuvB-like 2

SCOPe Domain Sequences for d2cqaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cqaa1 b.40.4.14 (A:8-89) RuvB-like 2 protein, RUVBL2 (TIP49b) {Human (Homo sapiens) [TaxId: 9606]}
keeteiiegevveiqidrpatgtgskvgkltlkttemetiydlgtkmiesltkdkvqagd
vitidkatgkisklgrsftrar

SCOPe Domain Coordinates for d2cqaa1:

Click to download the PDB-style file with coordinates for d2cqaa1.
(The format of our PDB-style files is described here.)

Timeline for d2cqaa1: