SCOPe 2.06: Domain d2cnwe1: 2cnw E:23-78

Lineage for d2cnwe1 (2cnw E:23-78)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families)

5. Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)

6. Protein Signal recognition particle receptor, FtsY [47368] (3 species)

7. Species Thermus aquaticus [TaxId:271] [101122] (3 PDB entries)

8. Domain d2cnwe1: 2cnw E:23-78 [130657]
   Other proteins in same PDB: d2cnwa1, d2cnwa2, d2cnwb1, d2cnwb2, d2cnwc1, d2cnwc2, d2cnwd1, d2cnwd2, d2cnwe2, d2cnwf1, d2cnwf2
   automatically matched to d1okkd1
   protein/RNA complex; complexed with 5gp, alf, gdp, mg

Details for d2cnwe1

PDB Entry: 2cnw, 2.39 Å

PDB Description: gdpalf4 complex of the srp gtpases ffh and ftsy

PDB Compounds: (E:) cell division protein ftsy

SCOPe Domain Sequences for d2cnwe1:

Sequence, based on SEQRES records:

>d2cnwe1 a.24.13.1 (E:23-78) Signal recognition particle receptor, FtsY {Thermus aquaticus [TaxId: 271]}
pwggnleevleelemallaadvglsateeilqevrasgrkdlkeavkeklvgmlep

Sequence, based on observed residues (ATOM records):

>d2cnwe1 a.24.13.1 (E:23-78) Signal recognition particle receptor, FtsY {Thermus aquaticus [TaxId: 271]}
pwggnleevleelemallaadvglsateeilqevrgrkdlkeavkeklvgmlep

Timeline for d2cnwe1:

• d2cnwe1 first appeared in SCOP 1.73
  
• d2cnwe1 appears in SCOPe 2.05
  
• d2cnwe1 appears in SCOPe 2.07
  
• d2cnwe1 appears in the current release, SCOPe 2.08