Lineage for d2cfgb3 (2cfg B:97-211)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1895674Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1895888Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 1895889Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 1895890Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 1895891Species Arthrobacter globiformis [TaxId:1665] [54421] (40 PDB entries)
    Uniprot P46881 9-628
  8. 1895899Domain d2cfgb3: 2cfg B:97-211 [130381]
    Other proteins in same PDB: d2cfga1, d2cfgb1
    automated match to d1rjoa3
    complexed with cu, gol, na, r4a, so4

Details for d2cfgb3

PDB Entry: 2cfg (more details), 1.55 Å

PDB Description: agao in complex with wc4d3 (ru-wire inhibitor, 4-carbon linker, delta enantiomer, data set 3)
PDB Compounds: (B:) phenylethylamine oxidase

SCOPe Domain Sequences for d2cfgb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cfgb3 d.17.2.1 (B:97-211) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis [TaxId: 1665]}
elpvleeefevveqllatderwlkalaarnldvskvrvaplsagvfeyaeergrrilrgl
afvqdfpedsawahpvdglvayvdvvskevtrvidtgvfpvpaehgnytdpeltg

SCOPe Domain Coordinates for d2cfgb3:

Click to download the PDB-style file with coordinates for d2cfgb3.
(The format of our PDB-style files is described here.)

Timeline for d2cfgb3: