Class b: All beta proteins [48724] (177 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.12: VPS36 N-terminal domain-like [141442] (1 protein) PfamB PB030385 |
Protein Vacuolar protein sorting protein 36, VPS36 [141443] (3 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [141445] (1 PDB entry) Uniprot Q06696 1-99,252-282 |
Domain d2caya1: 2cay A:2-99,A:252-282 [130167] Other proteins in same PDB: d2caya2, d2cayb2 complexed with so4 |
PDB Entry: 2cay (more details), 1.9 Å
SCOPe Domain Sequences for d2caya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2caya1 b.55.1.12 (A:2-99,A:252-282) Vacuolar protein sorting protein 36, VPS36 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} eywhyvettssgqpllregekdifidqsvglyhgkskilqrqrgrifltsqriiyiddak ptqnslglelddlayvnyssgfltrsprlilffkdpssXstefvqlsfrksdgvlfsqat eralenilte
Timeline for d2caya1: