Lineage for d2c9wc_ (2c9w C:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1411215Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1411216Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1411217Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 1411266Protein Elongin C [54699] (3 species)
  7. 1411269Species Human (Homo sapiens) [TaxId:9606] [54700] (18 PDB entries)
  8. 1411271Domain d2c9wc_: 2c9w C: [130146]
    Other proteins in same PDB: d2c9wa1, d2c9wa2, d2c9wb_
    automated match to d1lm8c_
    complexed with ni, so4

Details for d2c9wc_

PDB Entry: 2c9w (more details), 1.9 Å

PDB Description: crystal structure of socs-2 in complex with elongin-b and elongin-c at 1.9a resolution
PDB Compounds: (C:) Transcription elongation factor B polypeptide 1

SCOPe Domain Sequences for d2c9wc_:

Sequence, based on SEQRES records: (download)

>d2c9wc_ d.42.1.1 (C:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d2c9wc_ d.42.1.1 (C:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamnevnfreipshvlskvcmyftykvryteipe
fpiapeialellmaanfldc

SCOPe Domain Coordinates for d2c9wc_:

Click to download the PDB-style file with coordinates for d2c9wc_.
(The format of our PDB-style files is described here.)

Timeline for d2c9wc_: