Lineage for d2c9wc1 (2c9w C:17-112)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 722003Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 722004Superfamily d.42.1: POZ domain [54695] (2 families) (S)
  5. 722005Family d.42.1.1: BTB/POZ domain [54696] (5 proteins)
  6. 722036Protein Elongin C [54699] (2 species)
  7. 722039Species Human (Homo sapiens) [TaxId:9606] [54700] (6 PDB entries)
  8. 722041Domain d2c9wc1: 2c9w C:17-112 [130146]
    Other proteins in same PDB: d2c9wb1
    automatically matched to d1lm8c_
    complexed with ni, so4

Details for d2c9wc1

PDB Entry: 2c9w (more details), 1.9 Å

PDB Description: crystal structure of socs-2 in complex with elongin-b and elongin-c at 1.9a resolution
PDB Compounds: (C:) Transcription elongation factor B polypeptide 1

SCOP Domain Sequences for d2c9wc1:

Sequence, based on SEQRES records: (download)

>d2c9wc1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d2c9wc1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamnevnfreipshvlskvcmyftykvryteipe
fpiapeialellmaanfldc

SCOP Domain Coordinates for d2c9wc1:

Click to download the PDB-style file with coordinates for d2c9wc1.
(The format of our PDB-style files is described here.)

Timeline for d2c9wc1: