Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (2 families) |
Family d.42.1.1: BTB/POZ domain [54696] (5 proteins) |
Protein Elongin C [54699] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54700] (6 PDB entries) |
Domain d2c9wc1: 2c9w C:17-112 [130146] Other proteins in same PDB: d2c9wb1 automatically matched to d1lm8c_ complexed with ni, so4 |
PDB Entry: 2c9w (more details), 1.9 Å
SCOP Domain Sequences for d2c9wc1:
Sequence, based on SEQRES records: (download)
>d2c9wc1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy ftykvrytnssteipefpiapeialellmaanfldc
>d2c9wc1 d.42.1.1 (C:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamnevnfreipshvlskvcmyftykvryteipe fpiapeialellmaanfldc
Timeline for d2c9wc1: