Lineage for d2c78a3 (2c78 A:9-212)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 987698Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 987996Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 988027Species Thermus thermophilus [TaxId:274] [52629] (7 PDB entries)
  8. 988028Domain d2c78a3: 2c78 A:9-212 [130039]
    Other proteins in same PDB: d2c78a1, d2c78a2
    automatically matched to d1aipa3
    complexed with gnp, mg, pul

Details for d2c78a3

PDB Entry: 2c78 (more details), 1.4 Å

PDB Description: ef-tu complexed with a gtp analog and the antibiotic pulvomycin
PDB Compounds: (A:) elongation factor tu-a

SCOPe Domain Sequences for d2c78a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}
kphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerargitintahv
eyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillarqvgv
pyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleqmhrnpkt
rrgenewvdkiwelldaideyipt

SCOPe Domain Coordinates for d2c78a3:

Click to download the PDB-style file with coordinates for d2c78a3.
(The format of our PDB-style files is described here.)

Timeline for d2c78a3: