SCOPe 2.07: Domain d2c77a3: 2c77 A:2-212

Lineage for d2c77a3 (2c77 A:2-212)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (80 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (34 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [255082] (2 PDB entries)

8. Domain d2c77a3: 2c77 A:2-212 [130036]
   Other proteins in same PDB: d2c77a1, d2c77a2
   automated match to d1b23p3
   complexed with gnp, mg, peg

Details for d2c77a3

PDB Entry: 2c77, 1.6 Å

PDB Description: ef-tu complexed with a gtp analog and the antibiotic ge2270 a

PDB Compounds: (A:) Elongation factor Tu-B

SCOPe Domain Sequences for d2c77a3:

Sequence; same for both SEQRES and ATOM records:

>d2c77a3 c.37.1.8 (A:2-212) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
kgefirtkphvnvgtighvdhgkttltaaltyvtaaenpnvevkdygdidkapeerargi
tintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehil
larqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleq
mhrnpktrrgenewvdkiwelldaideyipt

Timeline for d2c77a3:

• d2c77a3 first appeared in SCOP 1.73
  
• d2c77a3 appears in SCOPe 2.06
  
• d2c77a3 appears in the current release, SCOPe 2.08