Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (80 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (34 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [255082] (2 PDB entries) |
Domain d2c77a3: 2c77 A:2-212 [130036] Other proteins in same PDB: d2c77a1, d2c77a2 automated match to d1b23p3 complexed with gnp, mg, peg |
PDB Entry: 2c77 (more details), 1.6 Å
SCOPe Domain Sequences for d2c77a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c77a3 c.37.1.8 (A:2-212) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} kgefirtkphvnvgtighvdhgkttltaaltyvtaaenpnvevkdygdidkapeerargi tintahveyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehil larqvgvpyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleq mhrnpktrrgenewvdkiwelldaideyipt
Timeline for d2c77a3: