SCOP 1.73: Domain d2c77a3: 2c77 A:9-212

Lineage for d2c77a3 (2c77 A:9-212)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (78 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)

7. Species Thermus thermophilus [TaxId:274] [52629] (7 PDB entries)

8. Domain d2c77a3: 2c77 A:9-212 [130036]
   Other proteins in same PDB: d2c77a1, d2c77a2
   automatically matched to d1aipa3
   complexed with gea, gnp, mg, peg

Details for d2c77a3

PDB Entry: 2c77, 1.6 Å

PDB Description: ef-tu complexed with a gtp analog and the antibiotic ge2270 a

PDB Compounds: (A:) Elongation factor Tu-B

SCOP Domain Sequences for d2c77a3:

Sequence; same for both SEQRES and ATOM records:

>d2c77a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}
kphvnvgtighvdhgkttltaaltyvtaaenpnvevkdygdidkapeerargitintahv
eyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillarqvgv
pyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleqmhrnpkt
rrgenewvdkiwelldaideyipt

Timeline for d2c77a3:

• d2c77a3 is new in SCOP 1.73
  
• d2c77a3 appears in SCOP 1.75
  
• d2c77a3 appears in the current release, SCOPe 2.08