Class a: All alpha proteins [46456] (284 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (3 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (8 proteins) |
Protein Cyclin A [47956] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [47957] (52 PDB entries) Uniprot P20248 175-432 |
Domain d2c5ob1: 2c5o B:181-308 [129933] Other proteins in same PDB: d2c5oa_, d2c5oc_ automatically matched to d1vin_1 complexed with ck2 |
PDB Entry: 2c5o (more details), 2.1 Å
SCOPe Domain Sequences for d2c5ob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c5ob1 a.74.1.1 (B:181-308) Cyclin A {Human (Homo sapiens) [TaxId: 9606]} dihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhlavnyid rflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrmehlvlk vltfdlaa
Timeline for d2c5ob1:
View in 3D Domains from other chains: (mouse over for more information) d2c5oa_, d2c5oc_, d2c5od1, d2c5od2 |