Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.8: PFOR Pyr module [88746] (1 protein) domains VI, I and II are arranged in the same way as the TK PP, Pyr and C domains automatically mapped to Pfam PF01855 |
Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain I [88747] (1 species) |
Species Desulfovibrio africanus [TaxId:873] [88748] (10 PDB entries) |
Domain d2c3pa1: 2c3p A:2-258 [129760] Other proteins in same PDB: d2c3pa2, d2c3pa3, d2c3pa4, d2c3pa5, d2c3pb2, d2c3pb3, d2c3pb4, d2c3pb5 automated match to d1keka1 complexed with 1tp, ca, mg, sf4 |
PDB Entry: 2c3p (more details), 2.33 Å
SCOPe Domain Sequences for d2c3pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c3pa1 c.36.1.8 (A:2-258) Pyruvate-ferredoxin oxidoreductase, PFOR, domain I {Desulfovibrio africanus [TaxId: 873]} gkkmmttdgntatahvayamsevaaiypitpsstmgeeaddwaaqgrknifgqtltirem qseagaagavhgalaagaltttftasqglllmipnmykisgellpgvfhvtaraiaahal sifgdhqdiyaarqtgfamlasssvqeahdmalvahlaaiesnvpfmhffdgfrtsheiq kievldyadmaslvnqkalaefraksmnpehphvrgtaqnpdiyfqgreaanpyylkvpg ivaeymqkvasltgrsy
Timeline for d2c3pa1: