Lineage for d2byzb1 (2byz B:1-253)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1186520Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1186521Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1186522Family c.95.1.1: Thiolase-related [53902] (8 proteins)
  6. 1186543Protein Beta-ketoacyl-ACP synthase I [53907] (1 species)
  7. 1186544Species Escherichia coli [TaxId:562] [53908] (23 PDB entries)
    Uniprot P14926
  8. 1186611Domain d2byzb1: 2byz B:1-253 [129524]
    automatically matched to d1dd8a1
    complexed with dao, nh4; mutant

Details for d2byzb1

PDB Entry: 2byz (more details), 1.95 Å

PDB Description: structure of e.coli kas i h298q mutant in complex with c12 fatty acid
PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase I

SCOPe Domain Sequences for d2byzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2byzb1 c.95.1.1 (B:1-253) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]}
mkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
eelehalargahi

SCOPe Domain Coordinates for d2byzb1:

Click to download the PDB-style file with coordinates for d2byzb1.
(The format of our PDB-style files is described here.)

Timeline for d2byzb1: