Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) |
Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins) formerly omega-Aminoacid:pyruvate aminotransferase-like |
Protein automated matches [190152] (25 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255069] (1 PDB entry) |
Domain d2byjc_: 2byj C: [129485] Other proteins in same PDB: d2byja1 automated match to d2oata_ complexed with plp; mutant |
PDB Entry: 2byj (more details), 3.02 Å
SCOPe Domain Sequences for d2byjc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2byjc_ c.67.1.4 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gpptsddifereykygahnyhplpvalergkgiylwdvegrkyfdflssisavnqghchp kivnalksqvdkltltsrafynnvlgeyeeyitklfnyhkvlpmntgveagetacklark wgytvkgiqkykakivfaagnfwgrtlsaissstdptsydgfgpfmpgfdiipyndlpal eralqdpnvaafmvepiqgeagvvvpdpgylmgvrelctrhqvlfiadeiqtglartgrw lavdyenvrpdivllgkalsgglypvsavlcdddimltikpgehgstyggnplgcrvaia alevleeenlaenadklgiilrnelmklpsdvvtavrgkgllnaiviketkdwdawkvcl rlrdngllakpthgdiirfapplvikedelresieiinktilsf
Timeline for d2byjc_: