Lineage for d2byjb_ (2byj B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2503664Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2504021Protein automated matches [190152] (25 species)
    not a true protein
  7. 2504074Species Human (Homo sapiens) [TaxId:9606] [255069] (1 PDB entry)
  8. 2504075Domain d2byjb_: 2byj B: [129484]
    Other proteins in same PDB: d2byja1
    automated match to d2oata_
    complexed with plp; mutant

Details for d2byjb_

PDB Entry: 2byj (more details), 3.02 Å

PDB Description: ornithine aminotransferase mutant y85i
PDB Compounds: (B:) ornithine aminotransferase

SCOPe Domain Sequences for d2byjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2byjb_ c.67.1.4 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpptsddifereykygahnyhplpvalergkgiylwdvegrkyfdflssisavnqghchp
kivnalksqvdkltltsrafynnvlgeyeeyitklfnyhkvlpmntgveagetacklark
wgytvkgiqkykakivfaagnfwgrtlsaissstdptsydgfgpfmpgfdiipyndlpal
eralqdpnvaafmvepiqgeagvvvpdpgylmgvrelctrhqvlfiadeiqtglartgrw
lavdyenvrpdivllgkalsgglypvsavlcdddimltikpgehgstyggnplgcrvaia
alevleeenlaenadklgiilrnelmklpsdvvtavrgkgllnaiviketkdwdawkvcl
rlrdngllakpthgdiirfapplvikedelresieiinktilsf

SCOPe Domain Coordinates for d2byjb_:

Click to download the PDB-style file with coordinates for d2byjb_.
(The format of our PDB-style files is described here.)

Timeline for d2byjb_: