Lineage for d2bwva1 (2bwv A:1-176)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1859023Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (2 families) (S)
  5. 1859024Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (3 proteins)
  6. Protein automated matches [254492] (1 species)
    not a true protein
  7. Species Escherichia coli [TaxId:562] [255066] (7 PDB entries)
  8. 1859074Domain d2bwva1: 2bwv A:1-176 [129387]
    Other proteins in same PDB: d2bwva2
    automated match to d2v3za1
    complexed with cl, mn

Details for d2bwva1

PDB Entry: 2bwv (more details), 1.7 Å

PDB Description: his361ala escherichia coli aminopeptidase p
PDB Compounds: (A:) aminopeptidase p

SCOPe Domain Sequences for d2bwva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bwva1 c.55.2.1 (A:1-176) automated matches {Escherichia coli [TaxId: 562]}
seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfk

SCOPe Domain Coordinates for d2bwva1:

Click to download the PDB-style file with coordinates for d2bwva1.
(The format of our PDB-style files is described here.)

Timeline for d2bwva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bwva2