Lineage for d2bvya1 (2bvy A:371-464)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788950Superfamily b.1.18: E set domains [81296] (23 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 789056Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 789069Protein Beta-1,4-mannanase domain 2 (postcatalytic) [141020] (1 species)
  7. 789070Species Cellulomonas fimi [TaxId:1708] [141021] (2 PDB entries)
    Uniprot Q9XCV5 421-514
  8. 789071Domain d2bvya1: 2bvy A:371-464 [129301]
    Other proteins in same PDB: d2bvya2
    automatically matched to 2BVT A:371-464
    complexed with act, cac, gol

Details for d2bvya1

PDB Entry: 2bvy (more details), 2.25 Å

PDB Description: the structure and characterization of a modular endo-beta-1,4-mannanase from cellulomonas fimi
PDB Compounds: (A:) beta-1,4-mannanase

SCOP Domain Sequences for d2bvya1:

Sequence, based on SEQRES records: (download)

>d2bvya1 b.1.18.2 (A:371-464) Beta-1,4-mannanase domain 2 (postcatalytic) {Cellulomonas fimi [TaxId: 1708]}
aqpvvhiaspadgarvasapttvrvrvggtdvqsvtvevaqggtvvdtldlaydgalwwt
apwsptsaqldnstytvtatattaagtldvtnev

Sequence, based on observed residues (ATOM records): (download)

>d2bvya1 b.1.18.2 (A:371-464) Beta-1,4-mannanase domain 2 (postcatalytic) {Cellulomonas fimi [TaxId: 1708]}
aqpvvhiaspadgarvasapttvrvrvggtdvqsvtvevaqvvdtldlaydgalwwtapw
spytvtatattaagtldvtnev

SCOP Domain Coordinates for d2bvya1:

Click to download the PDB-style file with coordinates for d2bvya1.
(The format of our PDB-style files is described here.)

Timeline for d2bvya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bvya2