Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (20 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (19 proteins) domains of unknown function associated with different type of catalytic domains in a different sequential location subgroup of the larger IPT/TIG domain family |
Protein Beta-1,4-mannanase domain 2 (postcatalytic) [141020] (1 species) |
Species Cellulomonas fimi [TaxId:1708] [141021] (2 PDB entries) |
Domain d2bvya1: 2bvy A:371-464 [129301] Other proteins in same PDB: d2bvya2 automatically matched to 2BVT A:371-464 complexed with act, cac, gol |
PDB Entry: 2bvy (more details), 2.25 Å
SCOP Domain Sequences for d2bvya1:
Sequence, based on SEQRES records: (download)
>d2bvya1 b.1.18.2 (A:371-464) Beta-1,4-mannanase domain 2 (postcatalytic) {Cellulomonas fimi [TaxId: 1708]} aqpvvhiaspadgarvasapttvrvrvggtdvqsvtvevaqggtvvdtldlaydgalwwt apwsptsaqldnstytvtatattaagtldvtnev
>d2bvya1 b.1.18.2 (A:371-464) Beta-1,4-mannanase domain 2 (postcatalytic) {Cellulomonas fimi [TaxId: 1708]} aqpvvhiaspadgarvasapttvrvrvggtdvqsvtvevaqvvdtldlaydgalwwtapw spytvtatattaagtldvtnev
Timeline for d2bvya1: