Lineage for d2bvta2 (2bvt A:5-370)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1818795Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 1819258Protein Mannanase A, ManA [63908] (2 species)
  7. 1819259Species Cellulomonas fimi [TaxId:1708] [141776] (2 PDB entries)
    Uniprot Q9XCV5 55-420
  8. 1819261Domain d2bvta2: 2bvt A:5-370 [129298]
    Other proteins in same PDB: d2bvta1, d2bvtb1
    complexed with cac

Details for d2bvta2

PDB Entry: 2bvt (more details), 2.9 Å

PDB Description: the structure of a modular endo-beta-1,4-mannanase from cellulomonas fimi explains the product specificity of glycoside hydrolase family 26 mannanases.
PDB Compounds: (A:) beta-1,4-mannanase

SCOPe Domain Sequences for d2bvta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bvta2 c.1.8.3 (A:5-370) Mannanase A, ManA {Cellulomonas fimi [TaxId: 1708]}
tiaivdadataetrsllsyldgvrgegilfghqhttsfglttgptdgttsdvknvtgdfp
avfgwdtliiegnerpglaentrdenialfadyirkadaiggvntvsahvenfvtggsfy
dtsgdtlravlpggshhaelvaylddiaeladasrrddgtlipivfrpwhenagswfwwg
aaygspgeyqelyrftveylrdvkgvsnflyawgpgggfggnrdvylrtypgdafvdvlg
ldtydstgsdaflaglvadlrmiaeiadekgkvsaftefgvsggvgtngsspaqwftkvl
aaikadpvasrnaymetwanfdagqhfvpvpgdalledfqayaadpftlfasevtgafdr
tvaaap

SCOPe Domain Coordinates for d2bvta2:

Click to download the PDB-style file with coordinates for d2bvta2.
(The format of our PDB-style files is described here.)

Timeline for d2bvta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bvta1