Lineage for d2bv3a1 (2bv3 A:283-403)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2402482Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2402557Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2402558Family b.43.3.1: Elongation factors [50448] (11 proteins)
  6. 2402601Protein Elongation factor G (EF-G), domain II [50456] (2 species)
  7. 2402602Species Thermus thermophilus [TaxId:274] [50457] (9 PDB entries)
  8. 2402603Domain d2bv3a1: 2bv3 A:283-403 [129237]
    Other proteins in same PDB: d2bv3a2, d2bv3a3, d2bv3a4, d2bv3a5
    automatically matched to d1efga1
    complexed with gnp, mg; mutant

Details for d2bv3a1

PDB Entry: 2bv3 (more details), 2.5 Å

PDB Description: crystal structure of a mutant elongation factor g trapped with a gtp analogue
PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d2bv3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bv3a1 b.43.3.1 (A:283-403) Elongation factor G (EF-G), domain II {Thermus thermophilus [TaxId: 274]}
pldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvy
nttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvgedaprvilesi
e

SCOPe Domain Coordinates for d2bv3a1:

Click to download the PDB-style file with coordinates for d2bv3a1.
(The format of our PDB-style files is described here.)

Timeline for d2bv3a1: