Lineage for d2bv3a2 (2bv3 A:7-282)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2475315Protein Elongation factor G (EF-G), N-terminal (G) domain [52633] (2 species)
    has internal nucleotide exchange factor built in as an insertion subdomain
  7. 2475316Species Thermus thermophilus [TaxId:274] [52634] (9 PDB entries)
    residues 160-252 comprise insertion subdomain
  8. 2475317Domain d2bv3a2: 2bv3 A:7-282 [129238]
    Other proteins in same PDB: d2bv3a1, d2bv3a3, d2bv3a4, d2bv3a5
    automatically matched to d1dar_2
    complexed with gnp, mg; mutant

Details for d2bv3a2

PDB Entry: 2bv3 (more details), 2.5 Å

PDB Description: crystal structure of a mutant elongation factor g trapped with a gtp analogue
PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d2bv3a2:

Sequence, based on SEQRES records: (download)

>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}
ydlkrlrnigiaahidagktttterilyytgrihkigevhegaatmdfmeqerergitit
aavttcfwkdhriniidapghvdftieversmrvldgaivvfdssqgvepqsetvwrqae
kykvpriafankmdktgadlwlvirtmqerlgarpvvmqlpigredtfsgiidvlrmkay
tygndlgtdireipipeeyldqareyheklvevaadfdenimlkylegeepteeelvaai
rkgtidlkitpvflgsalknkgvqllldavvdylps

Sequence, based on observed residues (ATOM records): (download)

>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}
ydlkrlrnigiaahidagktttterilyytgrihkrgititaavttcfwkdhriniidap
ghvdftieversmrvldgaivvfdssqgvepqsetvwrqaekykvpriafankmdktgad
lwlvirtmqerlgarpvvmqlpigredtfsgiidvlrmkaytygndlgtdireipipeey
ldqareyheklvevaadfdenimlkylegeepteeelvaairkgtidlkitpvflgsalk
nkgvqllldavvdylps

SCOPe Domain Coordinates for d2bv3a2:

Click to download the PDB-style file with coordinates for d2bv3a2.
(The format of our PDB-style files is described here.)

Timeline for d2bv3a2: