SCOPe 2.02: Domain d2bucc2: 2buc C:509-766

Lineage for d2bucc2 (2buc C:509-766)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
   N-terminal domain is a 8-bladed beta-propeller

6. Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [89771] (8 PDB entries)

8. Domain d2bucc2: 2buc C:509-766 [129187]
   Other proteins in same PDB: d2buca1, d2bucb1, d2bucc1, d2bucd1
   automatically matched to d1orva2
   complexed with 008, nag, ndg, so4

Details for d2bucc2

PDB Entry: 2buc, 2.5 Å

PDB Description: crystal structure of porcine dipeptidyl peptidase iv (cd26) in complex with a tetrahydroisoquinoline inhibitor

PDB Compounds: (C:) dipeptidyl peptidase IV

SCOPe Domain Sequences for d2bucc2:

Sequence; same for both SEQRES and ATOM records:

>d2bucc2 c.69.1.24 (C:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
mpskkldvinlhgtkfwyqmilpphfdkskkypllievyagpcsqkvdtvfrlswatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieatrqfskmgfvddkriaiwg
wsyggyvtsmvlgagsgvfkcgiavapvskweyydsvyterymglptpednldyyrnstv
msraenfkqveyllihgtaddnvhfqqsaqlskalvdagvdfqtmwytdedhgiasnmah
qhiythmshflkqcfslp

Timeline for d2bucc2:

• d2bucc2 first appeared in SCOP 1.73
  
• d2bucc2 appears in SCOPe 2.01
  
• d2bucc2 appears in SCOPe 2.03
  
• d2bucc2 appears in the current release, SCOPe 2.08