Lineage for d2buac1 (2bua C:39-508)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1135692Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 1135781Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
  5. 1135782Family b.70.3.1: DPP6 N-terminal domain-like [82172] (2 proteins)
    Pfam PF00930
  6. 1135789Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)
  7. 1135914Species Pig (Sus scrofa) [TaxId:9823] [89381] (8 PDB entries)
  8. 1135929Domain d2buac1: 2bua C:39-508 [129174]
    Other proteins in same PDB: d2buaa2, d2buab2, d2buac2, d2buad2
    automatically matched to d1orva1
    complexed with 007, nag, ndg, so4

Details for d2buac1

PDB Entry: 2bua (more details), 2.56 Å

PDB Description: crystal structure of porcine dipeptidyl peptidase iv (cd26) in complex with a low molecular weight inhibitor.
PDB Compounds: (C:) dipeptidyl peptidase IV

SCOPe Domain Sequences for d2buac1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2buac1 b.70.3.1 (C:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
srrtytltdylkstfrvkfytlqwisdheylykqennillfnaeygnssiflenstfdel
gystndysvspdrqfilfeynyvkqwrhsytasydiydlnkrqliteeripnntqwitws
pvghklayvwnndiyvknepnlssqritwtgkenviyngvtdwvyeeevfsaysalwwsp
ngtflayaqfndtevplieysfysdeslqypktvripypkagaenptvkffvvdtrtlsp
nasvtsyqivppasvligdhylcgvtwvteerislqwirraqnysiidicdydestgrwi
ssvarqhieisttgwvgrfrpaephftsdgnsfykiisneegykhichfqtdksnctfit
kgawevigiealtsdylyyisnehkgmpggrnlyriqlndytkvtclscelnpercqyys
asfsnkakyyqlrcfgpglplytlhssssdkelrvlednsaldkmlqdvq

SCOPe Domain Coordinates for d2buac1:

Click to download the PDB-style file with coordinates for d2buac1.
(The format of our PDB-style files is described here.)

Timeline for d2buac1: