SCOP 1.73: Domain d2bt6b1: 2bt6 B:5-108

Lineage for d2bt6b1 (2bt6 B:5-108)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families)

5. Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (3 proteins)

6. Protein Adrenodoxin [54310] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54311] (6 PDB entries)

8. Domain d2bt6b1: 2bt6 B:5-108 [129153]
   automatically matched to d1e6eb_
   complexed with fes, mg, rua

Details for d2bt6b1

PDB Entry: 2bt6, 1.5 Å

PDB Description: ru(bpy)2(mbpy)-modified bovine adrenodoxin

PDB Compounds: (B:) Adrenodoxin 1

SCOP Domain Sequences for d2bt6b1:

Sequence; same for both SEQRES and ATOM records:

>d2bt6b1 d.15.4.1 (B:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]}
dkitvhfinrdgetlttkgkigdslldvvvqnnldidgfgacegtlacstchlifeqhif
ekleaitdeendmldlaygltdrsrlgcqicltkamdnmtvrvp

Timeline for d2bt6b1:

• d2bt6b1 is new in SCOP 1.73
  
• d2bt6b1 appears in SCOP 1.75
  
• d2bt6b1 appears in the current release, SCOPe 2.08, called d2bt6b_