Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) |
Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (3 proteins) |
Protein Adrenodoxin [54310] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [54311] (6 PDB entries) |
Domain d2bt6a1: 2bt6 A:5-108 [129152] automatically matched to d1e6eb_ complexed with fes, mg, rua |
PDB Entry: 2bt6 (more details), 1.5 Å
SCOP Domain Sequences for d2bt6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} dkitvhfinrdgetlttkgkigdslldvvvqnnldidgfgacegtlacstchlifeqhif ekleaitdeendmldlaygltdrsrlgcqicltkamdnmtvrvp
Timeline for d2bt6a1: