Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) |
Protein automated matches [190231] (14 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [186995] (1 PDB entry) |
Domain d2bt6b_: 2bt6 B: [129153] Other proteins in same PDB: d2bt6a3 automated match to d1l6ua_ complexed with fes, mg, rua |
PDB Entry: 2bt6 (more details), 1.5 Å
SCOPe Domain Sequences for d2bt6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bt6b_ d.15.4.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]} dkitvhfinrdgetlttkgkigdslldvvvqnnldidgfgacegtlacstchlifeqhif ekleaitdeendmldlaygltdrsrlgcqicltkamdnmtvrvp
Timeline for d2bt6b_: