SCOPe 2.08: Domain d2bt6b_: 2bt6 B:

Lineage for d2bt6b_ (2bt6 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)

6. Protein automated matches [190231] (14 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [186995] (1 PDB entry)

8. Domain d2bt6b_: 2bt6 B: [129153]
   Other proteins in same PDB: d2bt6a3
   automated match to d1l6ua_
   complexed with fes, mg, rua

Details for d2bt6b_

PDB Entry: 2bt6, 1.5 Å

PDB Description: ru(bpy)2(mbpy)-modified bovine adrenodoxin

PDB Compounds: (B:) Adrenodoxin 1

SCOPe Domain Sequences for d2bt6b_:

Sequence; same for both SEQRES and ATOM records:

>d2bt6b_ d.15.4.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
dkitvhfinrdgetlttkgkigdslldvvvqnnldidgfgacegtlacstchlifeqhif
ekleaitdeendmldlaygltdrsrlgcqicltkamdnmtvrvp

Timeline for d2bt6b_:

• d2bt6b_ first appeared in SCOP 1.73, called d2bt6b1
  
• d2bt6b_ appears in SCOPe 2.07