Lineage for d2bs3e1 (2bs3 E:107-239)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 904056Superfamily a.1.2: alpha-helical ferredoxin [46548] (2 families) (S)
    contains two Fe4-S4 clusters
  5. 904057Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (2 proteins)
  6. 904058Protein Fumarate reductase [46550] (2 species)
  7. 904070Species Wolinella succinogenes [TaxId:844] [46552] (5 PDB entries)
  8. 904074Domain d2bs3e1: 2bs3 E:107-239 [129050]
    Other proteins in same PDB: d2bs3a1, d2bs3a2, d2bs3a3, d2bs3b2, d2bs3c1, d2bs3d1, d2bs3d2, d2bs3d3, d2bs3e2, d2bs3f_
    automatically matched to d1e7pb1
    complexed with cit, f3s, fad, fes, hem, lmt, na, sf4

Details for d2bs3e1

PDB Entry: 2bs3 (more details), 2.19 Å

PDB Description: glu c180 -> gln variant quinol:fumarate reductase from wolinella succinogenes
PDB Compounds: (E:) quinol-fumarate reductase iron-sulfur subunit b

SCOPe Domain Sequences for d2bs3e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bs3e1 a.1.2.1 (E:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]}
tgnwfngmsqrveswihaqkehdiskleeriepevaqevfeldrciecgcciaacgtkim
redfvgaaglnrvvrfmidphdertdedyyeligdddgvfgcmtllachdvcpknlplqs
kiaylrrkmvsvn

SCOPe Domain Coordinates for d2bs3e1:

Click to download the PDB-style file with coordinates for d2bs3e1.
(The format of our PDB-style files is described here.)

Timeline for d2bs3e1: